PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.B03420.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 244aa    MW: 28040.9 Da    PI: 9.4013
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.B03420.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.81e-31959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  Pahal.B03420.1  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                    79***********************************************96 PP

2K-box98.31.1e-32861779100
           K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                     +e++  +s+++e+ kLk+++enLqr+qR+llGedL++L +keL+qLe+qL++sl++iRs++++++l+q+ +lq++e++l e+nk+Lr+klee
  Pahal.B03420.1  86 KENELVQSSRNEYLKLKARVENLQRTQRNLLGEDLGTLGIKELEQLEKQLDSSLRHIRSTRTQHMLDQLTDLQRREHMLCEANKCLRRKLEE 177
                     45667899*********************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.137161IPR002100Transcription factor, MADS-box
CDDcd002657.47E-44278No hitNo description
SuperFamilySSF554551.96E-32286IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.3E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-333859IPR002100Transcription factor, MADS-box
PfamPF014864.8E-2688175IPR002487Transcription factor, K-box
PROSITE profilePS5129715.3291181IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSG  60
QSSITKTLER YQKSSYGGPD TVIQNKENEL VQSSRNEYLK LKARVENLQR TQRNLLGEDL  120
GTLGIKELEQ LEKQLDSSLR HIRSTRTQHM LDQLTDLQRR EHMLCEANKC LRRKLEETSS  180
QVHGQQVWEH GANLLGYERQ SPQQGPSHVS NGFFHPLEVA PEPTLQIGFA PEHMNNFMPT  240
WLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A8e-33761771103Developmental protein SEPALLATA 3
4ox0_B8e-33761771103Developmental protein SEPALLATA 3
4ox0_C8e-33761771103Developmental protein SEPALLATA 3
4ox0_D8e-33761771103Developmental protein SEPALLATA 3
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4306940.0AJ430694.1 Zea mays mRNA for putative MADS-domain transcription factor (m27 gene).
GenBankBT0333980.0BT033398.1 Zea mays full-length cDNA clone ZM_BFb0100K01 mRNA, complete cds.
GenBankBT0879420.0BT087942.1 Zea mays full-length cDNA clone ZM_BFb0323H23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957288.11e-172PREDICTED: MADS-box transcription factor 8 isoform X1
SwissprotQ9SAR11e-157MADS8_ORYSJ; MADS-box transcription factor 8
TrEMBLK3ZWH81e-172K3ZWH8_SETIT; Uncharacterized protein
STRINGSi030960m1e-171(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34833469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.12e-91MIKC_MADS family protein